Protein Labeling Reagents
Vector Laboratories Peanut Agglutinin (PNA) Fluorescein-labeled 5 mg
Peanut agglutinin (PNA) binds the T-antigen, a galactosyl (β-1,3) N-acetylgalactosamine structure present in many glycoconjugates, such as M and N blood groups, gangliosides, and other soluble and membrane-associated glycoproteins and glycolipids. With exceptions, the PNA receptor sequence is normally sialylated, which prevents binding to its receptor oligosaccharide (see Jacalin). Sialic acid not bound to receptor sugars may also inhibit binding, and including calcium in diluents can enhance binding. This fluorescein-labeled PNA features a ratio of fluorophores to lectin protein that provides optimal staining (excitation 495 nm, emission 515 nm). Supplied as a solution essentially free of unconjugated fluorophores, it is preserved with sodium azide. The recommended inhibiting/eluting sugar is 200 mM galactose.
Biotium CF488A Protein Labeling Kit "3 labelings"
This kit contains everything you need to label antibodies or other proteins with a fluorescent CF dye succinimidyl ester (CF dye SE). Each kit contains reagents for three labeling reactions of up to 1 mg protein per reaction. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Green fluorescent CF488A dye has excitation/emission at 490/515 nm.
AnaSpec AMYLOID (1-40) N-TERMINAL
Beta-Amyloid (1-40), Human[DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4329.9; (0.5 mg) AB (1-40) together with AB (1-42) are two major C-terminal variants of the AB protein constituting the majority of ABs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Biotium CF568 Maleimide
CF Dye Maleimides are thiol-reactive fluorescent dyes. Maleimides are commonly used to label proteins on free thiol groups. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Red fluorescent CF568 dye has excitation/emission at 562/583 nm.
Biotium Biotin Picolyl Azide
Biotin picolyl azide reacts with alkyne to form 1,2,3-triazole by 1,3-dipolar Huisgen cycloaddition through the use of a much lower copper (I) concentration without sacrificing reaction efficiency.
![eMolecules 16090-02-1 | Fluorescent brightener 71 | Combi-Blocks | MFCD00071913 | 924.920 | C40H38N12Na2O8S2 | 97.000 | [Na+].[Na+].[O-]S(=O)(=O)c1cc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)ccc1\C=C\c1ccc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)cc1S([O-])(=O)=O | 1g | 205408224](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502212210.JPG-250.jpg)
eMolecules 16090-02-1 | Fluorescent brightener 71 | Combi-Blocks | MFCD00071913 | 924.920 | C40H38N12Na2O8S2 | 97.000 | [Na+].[Na+].[O-]S(=O)(=O)c1cc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)ccc1\C=C\c1ccc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)cc1S([O-])(=O)=O | 1g | 205408224
Fluorescent brightener 71 | Combi-Blocks | 16090-02-1 | MFCD00071913 | 924.920 | C40H38N12Na2O8S2 | 97.000 | [Na+].[Na+].[O-]S(=O)(=O)c1cc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)ccc1\C=C\c1ccc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)cc1S([O-])(=O)=O | 1g | 205408224
Cell Signaling Technology Alexa Fluor 555 Phalloidin 300 assays
Alexa Fluor 555 Phalloidin 300 assays
Biotium DI-4-ANEPPS
Di-4-ANEPPS is a fast-responding membrane potential dye. Changes in the membrane potential of the cell correlate with changes in the fluorescence excitation intensity of the dye. Properties: Ex/ Em(MeOH) = 496/705 nm; Orange red solid soluble in DMF, ethanol or DMSO; Store at 4°C and protect from light, especially in solution; C28H36N2O3S; MW: 48; [90134-00-2]
Biotium CF405L Protein Labeling Kit , 3x(1mg) labelings
This kit contains everything you need to label antibodies or other proteins with a fluorescent CF dye succinimidyl ester (CF dye SE). Each kit contains reagents for three labeling reactions of up to 1 mg protein per reaction. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. 405 nm-excitable green fluorescent CF405L dye has excitation/emission at 395/545 nm.
Biotium MitoView™ 650
MitoView™ 650 is a far-red mitochondrial stain for live cells. Its staining is not responsive to mitochondrial membrane potential. With excitation/emission at 644/670 nm, and can be combined with visible red probes for multicolor imaging.
Biotium Phalloidin, CF647, 300 U
Phalloidin conjugates are actin filament stains for fixed and permeabilized cells. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Far-red fluorescent CF647 has excitation/emission at 650/665 nm.
Biotium CF640R Protein Labeling Kit , 3x(1mg) labelings
This kit contains everything you need to label antibodies or other proteins with a fluorescent CF dye succinimidyl ester (CF dye SE). Each kit contains reagents for three labeling reactions of up to 1 mg protein per reaction. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Far-red fluorescent CF640R dye has excitation/emission at 642/662 nm.